Gefilterte Suchergebnisse
Produkte von einigen unserer Lieferanten werden in den gefilterten Suchergebnissen nicht angezeigt. Bitte
deaktivieren Sie alle Filter,
um diese Produkte zu sehen.
1
–
15
von
951,841
Ergebnisse
Separase Antibody (XJ11-1B12) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody has been used in 1 publication
| Klon | XJ11-1B12 |
|---|---|
| Form | Purified |
| Gen-Zugriffsnummer | Q14674 |
| Konjugat | Unconjugated |
| Isotype | IgG1 κ |
| Gensymbole | ESPL1 |
| Konzentration | 0.9 mg/mL |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Klassifikation | Monoclonal |
| Antigen | Separase |
| Regulatorischer Status | RUO |
| Immunogen | Maltose-Binding Protein fusion of a C-terminal fragment of human Separase (residues 1866-1996). [UniProt# Q14674] |
| Zielspezies | Human |
| Forschungsgebiet | Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Chromatin Research, DNA Repair, Mitotic Regulators |
| Wirtsspezies | Mouse |
| Reinigungsverfahren | Protein G purified |
| Anwendungen | Western Blot |
| Verdünnung | Western Blot 1:500 |
| Gen-Alias | Caspase-like protein ESPL1, EC 3.4.22.49, ESP1extra spindle poles like 1, extra spindle pole bodies homolog 1 (S. cerevisiae), extra spindle poles like 1 (S. cerevisiae), Extra spindle poles-like 1 protein, FLJ46492, KIAA0165separin, Separase |
| Gen-ID (Entrez) | 9700 |
| Gensymbol | SNCA |
|---|---|
| Zusammensetzung | PBS pH 7.4 |
| Lagerungsbedingungen | Store at -80C. Avoid freeze-thaw cycles. |
| Forschungskategorie | Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience |
| Zur Verwendung mit (Anwendung) | Electron Microscopy,In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot |
| Gen-Alias | alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein |
| Protein | alpha-Synuclein |
| Reinheits- oder Qualitätsgrad | >95%, by SDS-PAGE |
| Gen-ID (Entrez) | 6622 |
| Gensymbole | TP53BP1 |
|---|---|
| Gen-Alias | 53BP1, p202, p53-binding protein 1, p53bp1, TDRD30, TP53-Binding Protein 1, tumor protein 53-binding protein, 1, tumor protein p53 binding protein 1, tumor protein p53-binding protein, 1, tumor suppressor p53-binding protein 1 |
Listeria monocytogenes p60, Mouse anti-Bacteria, Clone: p6007, Novus Biologicals™
Mouse Monoclonal Antibody
| Testspezifität | Recognizes Listeria monocytogenes p60 protein. Does not cross-react with other Listeria species. |
|---|---|
| Klon | p6007 |
| Form | Purified |
| Konjugat | Unconjugated |
| Isotype | IgG1 κ |
| Konzentration | 1 mg/mL |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Zusammensetzung | 0.2um-filtered solution in PBS, pH 7.4. |
| Klassifikation | Monoclonal |
| Antigen | Listeria monocytogenes p60 |
| Regulatorischer Status | RUO |
| Immunogen | Recombinant Listeria monocytogenes p60. |
| Zielspezies | Bacteria |
| Wirtsspezies | Mouse |
| Reinigungsverfahren | Protein G purified |
| Anwendungen | Western Blot,ELISA |
| Verdünnung | Western Blot, ELISA |
| Gen-Alias | IAP p60 from Listeria Monocytogenes, Invasion-associated Protein p60, Invasion-associated Protein p60 from Listeria Monocytogenes, invasion-associated-protein, p60 protein |
GM130/GOLGA2 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 6 publications
| Konjugat | Unconjugated |
|---|---|
| Isotype | IgG |
| Gensymbole | GOLGA2 |
| Konzentration | 1.0 mg/mL |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Zusammensetzung | PBS with 0.02% Sodium Azide |
| Klassifikation | Polyclonal |
| Antigen | GM130/GOLGA2 |
| Regulatorischer Status | RUO |
| Immunogen | Partial recombinant human GM130/GOLGA2 protein (amino acids 528-606). [UniPro Q08379] |
| Zielspezies | Human,Mouse |
| Forschungsgebiet | Cellular Markers, Golgi Apparatus Markers |
| Wirtsspezies | Rabbit |
| Reinigungsverfahren | Affinity Purified |
| Anwendungen | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
| Verdünnung | Western Blot 0.5 ug/ml, Immunohistochemistry 1:1000 - 1:1500, Immunocytochemistry/Immunofluorescence 5 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:1500 |
| Gen-Alias | 130 kDa cis-Golgi matrix protein, GM130 autoantigen, GM130Golgi matrix protein GM130, golgi autoantigen, golgin subfamily a, 2, golgin A2, Golgin subfamily A member 2, golgin-95, MGC20672, SY11 protein |
| Gen-ID (Entrez) | 2801 |
PAK1/2/3, p Thr423, p Thr402, p Thr421 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
| Gen-Zugriffsnummer | Q13153//Q13177//O75914 |
|---|---|
| Konjugat | Unconjugated |
| Isotype | IgG |
| Gensymbole | PAK1 |
| Konzentration | 1.0 mg/mL |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Klassifikation | Polyclonal |
| Antigen | PAK1/2/3 (p Thr423, p Thr402, p Thr421) |
| Regulatorischer Status | RUO |
| Zielspezies | Rat,Human,Mouse |
| Forschungsgebiet | Apoptosis, Breast Cancer, Cancer, Neuroscience, Phospho Specific, Signal Transduction |
| Wirtsspezies | Rabbit |
| Reinigungsverfahren | Affinity Purified |
| Anwendungen | Immunohistochemistry (Paraffin),Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence |
| Gen-Alias | alpha-PAK, EC 2.7.11, EC 2.7.11.1, MGC130000, MGC130001, p21 protein (Cdc42/Rac)-activated kinase 1, p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast), p21/Cdc42/Rac1-activated kinase 1 (yeast Ste20-related), p21-activated kinase 1, p65-PAK, PAK-1, PAKalpha, serine/threonine-protein kinase PAK 1, STE20 homolog, yeast |
| Gen-ID (Entrez) | 5058 |
| Testspezifität | Specificity of human RWDD4A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
|---|---|
| Konjugat | Unconjugated |
| Isotype | IgG |
| Gensymbole | RWDD4 |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Zusammensetzung | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Klassifikation | Polyclonal |
| Antigen | RWDD4A |
| Regulatorischer Status | RUO |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:EALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEISWTETYPQTPPILSMNAFFNNTISSAVKQSILAKLQEAVEANLGTAM |
| Zielspezies | Human,Mouse,Rat |
| Wirtsspezies | Rabbit |
| Reinigungsverfahren | Affinity Purified |
| Anwendungen | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Verdünnung | Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Gen-Alias | FAM28A, member A, MGC10198, Protein FAM28A, RWD domain containing 4, RWD domain containing 4A, RWD domain-containing protein 4, RWD domain-containing protein 4A, RWDD4A |
| Gen-ID (Entrez) | 201965 |
CaMKII alpha/beta, p Thr286, p Thr287 Antibody (22B1), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 4 publications
| Testspezifität | This antibody is specific for a and B subunits of CaMKII only when they are phosphorylated at Thr-286/287 (in B). |
|---|---|
| Klon | 22B1 |
| Form | Purified |
| Gen-Zugriffsnummer | P11275 |
| Konjugat | Unconjugated |
| Isotype | IgG1 |
| Gensymbole | CAMK2A |
| Konzentration | 1 mg/mL |
| Primär oder sekundär | Primary |
| Inhalt und Lagerung | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Klassifikation | Monoclonal |
| Antigen | CaMKII alpha/beta (p Thr286, p Thr287) |
| Regulatorischer Status | RUO |
| Immunogen | Synthetic peptide |
| Zielspezies | Human |
| Forschungsgebiet | Phospho Specific, Wnt Signaling Pathway |
| Wirtsspezies | Mouse |
| Reinigungsverfahren | Protein G purified |
| Anwendungen | Western Blot |
| Verdünnung | Western Blot 1 μg/mL, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500, Immunoblotting |
| Gen-Alias | calcium/calmodulin-dependent protein kinase (CaM kinase) II alpha, calcium/calmodulin-dependent protein kinase II alpha, calcium/calmodulin-dependent protein kinase II alpha-B subunit, CaM kinase II alpha subunit, CaM kinase II subunit alpha, CAMKAcalcium/calmodulin-dependent protein kinase type II subunit alpha, CaMK-II alpha subunit, CaMK-II subunit alpha, CaMKIINalpha, CaM-kinase II alpha chain, EC 2.7.11, EC 2.7.11.17, KIAA0968calcium/calmodulin-dependent protein kinase type II alpha chain |
| Gen-ID (Entrez) | 815 |
Bassoon Antibody (SAP7F407), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 7 publications
| Testspezifität | This affinity purified detects an ∼400 kDa protein, corresponding to the apparent molecular mass of Bassoon on SDSPAGE immunoblots, in samples from mouse and rat origins. Additional bands between 97 and 400 kDa may also be detected. |
|---|---|
| Klon | SAP7F407 |
| Form | Purified |
| Gen-Zugriffsnummer | O88778 |
| Konjugat | Unconjugated |
| Gensymbole | BSN |
| Konzentration | 1.0 mg/mL |
| Primär oder sekundär | Primary |
| Molekulargewicht des Antigens | 400 kDa |
| Inhalt und Lagerung | Store at -20C. Avoid freeze-thaw cycles. |
| Klassifikation | Monoclonal |
| Antigen | Bassoon |
| Regulatorischer Status | RUO |
| Immunogen | Recombinant rat Bassoon. |
| Zielspezies | Rat,Mouse |
| Wirtsspezies | Mouse |
| Reinigungsverfahren | Protein G purified |
| Anwendungen | Immunofluorescence,Immunohistochemistry,Immunocytochemistry,Western Blot,Immunoprecipitation,Immunohistochemistry (Paraffin) |
| Verdünnung | Western Blot 1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:400, Immunoprecipitation 2.5 ug, Immunohistochemistry-Paraffin 1:10-1:500, Immunohistochemistry-Frozen |
| Gen-Alias | bassoon (presynaptic cytomatrix protein) |
| Gen-ID (Entrez) | 8927 |