Bio Techne

1 – 15 von 951,841 Ergebnisse

Mouse Monoclonal Antibody has been used in 1 publication

Klon	XJ11-1B12
Form	Purified
Gen-Zugriffsnummer	Q14674
Konjugat	Unconjugated
Isotype	IgG1 κ
Gensymbole	ESPL1
Konzentration	0.9 mg/mL
Primär oder sekundär	Primary
Inhalt und Lagerung	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Klassifikation	Monoclonal
Antigen	Separase
Regulatorischer Status	RUO
Immunogen	Maltose-Binding Protein fusion of a C-terminal fragment of human Separase (residues 1866-1996). [UniProt# Q14674]
Zielspezies	Human
Forschungsgebiet	Apoptosis, Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Chromatin Research, DNA Repair, Mitotic Regulators
Wirtsspezies	Mouse
Reinigungsverfahren	Protein G purified
Anwendungen	Western Blot
Verdünnung	Western Blot 1:500
Gen-Alias	Caspase-like protein ESPL1, EC 3.4.22.49, ESP1extra spindle poles like 1, extra spindle pole bodies homolog 1 (S. cerevisiae), extra spindle poles like 1 (S. cerevisiae), Extra spindle poles-like 1 protein, FLJ46492, KIAA0165separin, Separase
Gen-ID (Entrez)	9700

Mouse Monoclonal Antibody

Gensymbol	SNCA
Zusammensetzung	PBS pH 7.4
Lagerungsbedingungen	Store at -80C. Avoid freeze-thaw cycles.
Forschungskategorie	Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience
Zur Verwendung mit (Anwendung)	Electron Microscopy,In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot
Gen-Alias	alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein
Protein	alpha-Synuclein
Reinheits- oder Qualitätsgrad	>95%, by SDS-PAGE
Gen-ID (Entrez)	6622

ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.

Rabbit Polyclonal Antibody

Gensymbole	TP53BP1
Gen-Alias	53BP1, p202, p53-binding protein 1, p53bp1, TDRD30, TP53-Binding Protein 1, tumor protein 53-binding protein, 1, tumor protein p53 binding protein 1, tumor protein p53-binding protein, 1, tumor suppressor p53-binding protein 1

Mouse Monoclonal Antibody

Testspezifität	Recognizes Listeria monocytogenes p60 protein. Does not cross-react with other Listeria species.
Klon	p6007
Form	Purified
Konjugat	Unconjugated
Isotype	IgG1 κ
Konzentration	1 mg/mL
Primär oder sekundär	Primary
Inhalt und Lagerung	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Zusammensetzung	0.2um-filtered solution in PBS, pH 7.4.
Klassifikation	Monoclonal
Antigen	Listeria monocytogenes p60
Regulatorischer Status	RUO
Immunogen	Recombinant Listeria monocytogenes p60.
Zielspezies	Bacteria
Wirtsspezies	Mouse
Reinigungsverfahren	Protein G purified
Anwendungen	Western Blot,ELISA
Verdünnung	Western Blot, ELISA
Gen-Alias	IAP p60 from Listeria Monocytogenes, Invasion-associated Protein p60, Invasion-associated Protein p60 from Listeria Monocytogenes, invasion-associated-protein, p60 protein

Rabbit Polyclonal Antibody

Testspezifität	Specificity of human RWDD4A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Konjugat	Unconjugated
Isotype	IgG
Gensymbole	RWDD4
Primär oder sekundär	Primary
Inhalt und Lagerung	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Zusammensetzung	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Klassifikation	Polyclonal
Antigen	RWDD4A
Regulatorischer Status	RUO
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:EALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEISWTETYPQTPPILSMNAFFNNTISSAVKQSILAKLQEAVEANLGTAM
Zielspezies	Human,Mouse,Rat
Wirtsspezies	Rabbit
Reinigungsverfahren	Affinity Purified
Anwendungen	Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin)
Verdünnung	Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gen-Alias	FAM28A, member A, MGC10198, Protein FAM28A, RWD domain containing 4, RWD domain containing 4A, RWD domain-containing protein 4, RWD domain-containing protein 4A, RWDD4A
Gen-ID (Entrez)	201965

Native Protein

Mouse Monoclonal Antibody has been used in 4 publications

Testspezifität	This antibody is specific for a and B subunits of CaMKII only when they are phosphorylated at Thr-286/287 (in B).
Klon	22B1
Form	Purified
Gen-Zugriffsnummer	P11275
Konjugat	Unconjugated
Isotype	IgG1
Gensymbole	CAMK2A
Konzentration	1 mg/mL
Primär oder sekundär	Primary
Inhalt und Lagerung	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Klassifikation	Monoclonal
Antigen	CaMKII alpha/beta (p Thr286, p Thr287)
Regulatorischer Status	RUO
Immunogen	Synthetic peptide
Zielspezies	Human
Forschungsgebiet	Phospho Specific, Wnt Signaling Pathway
Wirtsspezies	Mouse
Reinigungsverfahren	Protein G purified
Anwendungen	Western Blot
Verdünnung	Western Blot 1 μg/mL, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500, Immunoblotting
Gen-Alias	calcium/calmodulin-dependent protein kinase (CaM kinase) II alpha, calcium/calmodulin-dependent protein kinase II alpha, calcium/calmodulin-dependent protein kinase II alpha-B subunit, CaM kinase II alpha subunit, CaM kinase II subunit alpha, CAMKAcalcium/calmodulin-dependent protein kinase type II subunit alpha, CaMK-II alpha subunit, CaMK-II subunit alpha, CaMKIINalpha, CaM-kinase II alpha chain, EC 2.7.11, EC 2.7.11.17, KIAA0968calcium/calmodulin-dependent protein kinase type II alpha chain
Gen-ID (Entrez)	815