Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
1
–
15
of
952,099
results
Novus Biologicals™ Human HBsAg ELISA Kit (Colorimetric)
ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.
| Gene Symbols | TP53BP1 |
|---|---|
| Gene Alias | 53BP1, p202, p53-binding protein 1, p53bp1, TDRD30, TP53-Binding Protein 1, tumor protein 53-binding protein, 1, tumor protein p53 binding protein 1, tumor protein p53-binding protein, 1, tumor suppressor p53-binding protein 1 |
Listeria monocytogenes p60, Mouse anti-Bacteria, Clone: p6007, Novus Biologicals™
Mouse Monoclonal Antibody
| Content And Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Bacteria |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot,ELISA |
| Form | Purified |
| Isotype | IgG1 κ |
| Concentration | 1 mg/mL |
| Antigen | Listeria monocytogenes p60 |
| Regulatory Status | RUO |
| Purification Method | Protein G purified |
| Dilution | Western Blot, ELISA |
| Gene Alias | IAP p60 from Listeria Monocytogenes, Invasion-associated Protein p60, Invasion-associated Protein p60 from Listeria Monocytogenes, invasion-associated-protein, p60 protein |
| Formulation | 0.2um-filtered solution in PBS, pH 7.4. |
| Immunogen | Recombinant Listeria monocytogenes p60. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Test Specificity | Recognizes Listeria monocytogenes p60 protein. Does not cross-react with other Listeria species. |
| Clone | p6007 |
Rabbit IgG Isotype Control, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 36 publications
Histone H2AX, p Ser139 Antibody (3F2), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 6 publications
| Content And Storage | Store at -20°C. Avoid freeze/thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Mouse |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Purified |
| Isotype | IgG1 κ |
| Gene Accession No. | P16104 |
| Research Discipline | Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair, Epigenetics, Mitotic Regulators, Phospho Specific |
| Concentration | 1 mg/mL |
| Antigen | Histone H2AX (p Ser139) |
| Gene Symbols | H2AFX |
| Regulatory Status | RUO |
| Purification Method | Protein G purified |
| Dilution | Western Blot 1 μg/mL, Simple Western 10 μg/mL, Flow Cytometry 1 μg 106 cells, ELISA 1:100 - 1:2000, Immunohistochemistry 1:10 - 1:500, Immunocytochemistry/Immunofluorescence 2 - 4 μg/mL, Immunohistochemistry-Paraffin 1:10 - 1:500 |
| Molecular Weight of Antigen | 15 kDa |
| Gene Alias | H2A.X, H2A/X, H2AFX |
| Gene ID (Entrez) | 3014 |
| Immunogen | This Histone H2AX [p Ser139] Antibody (3F2) was developed against a synthetic peptide sequence surrounding phosphorylated Ser139. |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Test Specificity | In Western blot this antibody detects ∼17 kDa protein representing phosphorylated H2AX in gamma irradiated HeLa cell lysate. In immunofluorescence procedures, recognizes phosphorylated H2AX in gamma irradiated HeLa cells. ELISA of phosphorylated H2AX can also be performed. Used in IHC to successfully detect H2A.X pSer140 in postnatal mouse lung section. |
| Clone | 3F2 |
| Purity or Quality Grade | >97% pure by SDS-PAGE and HPLC |
|---|---|
| Gene Alias | Immunoglobulin G binding protein A, SPA, Staphylococcal protein A |
| Molecular Weight (g/mol) | 33.4 kDa |
| Gene ID (Entrez) | 3919448 |
| Formulation | Lyophilized from additive free solution. |
| Research Category | Epitope Tags |
| Reconstitution | Dissolve in distilled water or saline. |
| Endotoxin Concentration | Less than 0.1 EU/ug of Protein A as determined by LAL method. |
| Storage Requirements | Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles. |
| Concentration | LYOPH |
| For Use With (Application) | PAGE,Bioactivity,HPLC |
| Protein | Protein A |
| Target Species | Human,Mouse |
|---|---|
| Classification | Polyclonal |
| Isotype | IgG |
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
| Isotype | IgG |
| Antigen | KERA |
| Gene Symbols | KERA |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200 |
| Gene Alias | CNA2, keratocan, KTN, SLRR2BKeratan sulfate proteoglycan keratocan |
| Gene ID (Entrez) | 11081 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:SRSVRQVYEVHDSDDWTIHDFECPMECFCPPSFPTALYCENRGLKEIPAIPSRIWYLYL |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | Specificity of human KERA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |