missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
ALS2CR2 Polyclonal antibody specifically detects ALS2CR2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | ALS2CR2 |
| Anwendungen | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Verdünnung | Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Zusammensetzung | PBS (pH 7.2) and 40% Glycerol |
| Gen-Zugriffsnummer | Q9C0K7 |
| Gen-Alias | ALS2CR2candidate 2, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 2 protein, CALS-21MGC102916, ILP-interacting protein, ILPIPSTRAD beta, Pseudokinase ALS2CR2, STE20-related kinase adaptor beta |
| Wirtsspezies | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VPFQDMHRTQMLLQKLKGPPYSPLDISIFPQSESRMKNSQSGVDSGIGESVLVSSGTHTVNSDRLHTPSS |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?