missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. ALS2CR2 Antibody, Novus Biologicals™

ALS2CR2 Antibody, Novus Biologicals™

Product Code. 18499621 Shop All Bio Techne Products
Change view
Click to view available options
Menge:
0.1 mL
25 μL
Unit Size:
0.10 Milliliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Menge unitSize
18499621 0.1 mL 0.10 Milliliter
18441392 25 μL 25 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18499621 Supplier Novus Biologicals Supplier No. NBP190183

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

ALS2CR2 Polyclonal antibody specifically detects ALS2CR2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen ALS2CR2
Anwendungen Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Zusammensetzung PBS (pH 7.2) and 40% Glycerol
Gen-Zugriffsnummer Q9C0K7
Gen-Alias ALS2CR2candidate 2, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 2 protein, CALS-21MGC102916, ILP-interacting protein, ILPIPSTRAD beta, Pseudokinase ALS2CR2, STE20-related kinase adaptor beta
Wirtsspezies Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: VPFQDMHRTQMLLQKLKGPPYSPLDISIFPQSESRMKNSQSGVDSGIGESVLVSSGTHTVNSDRLHTPSS
Reinigungsverfahren Immunogen affinity purified
Menge 0.1 mL
Regulatorischer Status RUO
Forschungsgebiet Apoptosis, Protein Kinase, Signal Transduction
Primär oder sekundär Primary
Gen-ID (Entrez) 55437
Zielspezies Human, Mouse
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.