missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. 16164854

Rho GTPase activating protein 1, Mouse, Polyclonal Antibody, Abnova™

Artikelnummer. 16164854
Change view
Click to view available options
Menge:
50 μL
Unit Size:
50 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Menge unitSize
16164854 50 μL 50 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16164854 Supplier Abnova Supplier No. H00000392A01.50uL

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

This item is not returnable. View return policy

Description

Mouse polyclonal antibody raised against a partial recombinant ARHGAP1.

Sequence: GFLNIDESQRVPATLQVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFTKFLLDHQGELFPSPDPSGL

Specifications

Antigen Rho GTPase activating protein 1
Anwendungen ELISA, Western Blot
Klassifikation Polyclonal
Konjugat Unconjugated
Beschreibung Mouse polyclonal antibody raised against a partial recombinant ARHGAP1.
Zusammensetzung 50% glycerol
Gen ARHGAP1
Gen-Zugriffsnummer BC018118
Gen-Alias CDC42GAP/RHOGAP/RHOGAP1/p50rhoGAP
Gensymbole ARHGAP1
Wirtsspezies Mouse
Immunogen ARHGAP1 (AAH18118, 340 a.a. ∼ 439 a.a) partial recombinant protein with GST tag.
Menge 50 μL
Regulatorischer Status RUO
Forschungsgebiet Membrane Receptors
Ganzes Molekül Yes
Primär oder sekundär Primary
Gen-ID (Entrez) 392
Zielspezies Human, Mouse, Rat
Inhalt und Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.