missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. 16106674

CRX, Mouse, Clone: 2F12, Abnova™

Artikelnummer. 16106674
Change view
Click to view available options
Menge:
100 μg
Packungsgröße:
100 Mikrogramm
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
16106674 100 μg 100 Mikrogramm
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 16106674 Lieferant Abnova Lieferanten-Nr. H00001406M03.100ug

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Mouse monoclonal antibody raised against a partial recombinant CRX.

The protein encoded by this gene is a photoreceptor-specific transcription factor which plays a role in the differentiation of photoreceptor cells. This homeodomain protein is necessary for the maintenance of normal cone and rod function. Mutations in this gene are associated with photoreceptor degeneration, Leber congenital amaurosis type III and the autosomal dominant cone-rod dystrophy 2. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined. [provided by RefSeq

Sequence: MMAYMNPGPHYSVNALALSGPSVDLMHQAVPYPSAPRKQRRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFKNRRAKCR

Spezifikation

Antigen CRX
Anwendungen ELISA, Western Blot
Klassifikation Monoclonal
Klon 2F12
Konjugat Unconjugated
Beschreibung Mouse monoclonal antibody raised against a partial recombinant CRX.
Zusammensetzung PBS with no preservative; pH 7.4
Gen CRX
Gen-Zugriffsnummer NM_000554
Gen-Alias CORD2/CRD/LCA7/OTX3
Gensymbole CRX
Wirtsspezies Mouse
Immunogen CRX (NP_000545, 1 a.a. ∼ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Reinigungsverfahren Affinity chromatography
Menge 100 μg
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 1406
Zielspezies Human, Rat
Inhalt und Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Produkttyp Antibody
Form Liquid
Isotype IgG2a κ
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.