missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. 16167534

EPH receptor A2, Mouse, Clone: 1E3, Abnova™

Artikelnummer. 16167534
Change view
Click to view available options
Menge:
100 μg
Packungsgröße:
100 Mikrogramm
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
16167534 100 μg 100 Mikrogramm
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 16167534 Lieferant Abnova Lieferanten-Nr. H00001969M02.100ug

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Mouse monoclonal antibody raised against a partial recombinant EPHA2.

This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene encodes a protein that binds ephrin-A ligands. [provided by RefSeq

Sequence: LLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGGEEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCT

Spezifikation

Antigen EPH receptor A2
Anwendungen ELISA, Immunofluorescence, Western Blot
Klassifikation Monoclonal
Klon 1E3
Konjugat Unconjugated
Beschreibung Mouse monoclonal antibody raised against a partial recombinant EPHA2.
Zusammensetzung PBS with no preservative; pH 7.4
Gen EPHA2
Gen-Zugriffsnummer BC037166
Gen-Alias ECK
Gensymbole EPHA2
Wirtsspezies Mouse
Immunogen EPHA2 (AAH37166, 204 a.a. ∼ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Reinigungsverfahren Affinity Purified
Menge 100 μg
Regulatorischer Status RUO
Forschungsgebiet Kinases
Ganzes Molekül Yes
Primär oder sekundär Primary
Gen-ID (Entrez) 1969
Zielspezies Human
Inhalt und Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Produkttyp Antibody
Isotype IgG3 κ
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.