missing translation for 'onlineSavingsMsg'
Learn More

anti-Hyaluronan Synthase 3/HAS3, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Marke:  Novus Biologicals (Bio-Techne) NBP1-86328

Weitere Details : Netto-Gewicht : 0.01000kg

Artikelnummer. 15745016

  • 455.02 € / 0.10 Milliliter


Voraussichtlicher Liefertermin 06-08-2019
Zum Warenkorb hinzufügen

Beschreibung

Beschreibung

Hyaluronan Synthase 3/HAS3 Polyclonal antibody specifically detects Hyaluronan Synthase 3/HAS3 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Spezifikation

Spezifikation

Hyaluronan Synthase 3/HAS3
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
EC 2.4.1.212, HA synthase 3, hyaluronan synthase 3, Hyaluronate synthase 3, Hyaluronic acid synthase 3
Rabbit
IgG
0.1 ml
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:10-1:20
Affinity Purified
HAS3
This antibody was developed against Recombinant Protein corresponding to amino acids:RQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSC
Immunogen affinity purified
RUO
Primary
3038
Human, Rat
Videos
Dokumentation

For Research Use Only