missing translation for 'onlineSavingsMsg'
Learn More

pyruvate dehydrogenase kinase, isozyme 3, Mouse, Clone: 3A1, Abnova™

Mouse monoclonal antibody raised against a partial recombinant PDK3.

Marke:  Abnova H00005165-M02.100ug

Weitere Details : Netto-Gewicht : 0.00010kg

Artikelnummer. 16162575

  • 317.00 € / 100 Mikrogramm

Verfügbar ab
09-01-2020

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

Sequence: GDTNPVHPKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAKAPDKPIQVVYVPSHLFHMLFELFKNSMRATVELYEDR
Spezifikation

Spezifikation

pyruvate dehydrogenase kinase, isozyme 3
3A1
Mouse monoclonal antibody raised against a partial recombinant PDK3.
PDK3
Affinity Purified
Mouse
IgG1 Kappa
100 ug
Kinases
Y
Monoclonal
Human
ELISA, Western Blot
Unconjugated
In 1X PBS, pH 7.4
BC015948
PDK3
PDK3 (AAH15948, 174 a.a. ~ 263 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Protein A column
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
5165
Videos
Dokumentation