pyruvate dehydrogenase kinase, isozyme 3, Mouse, Clone: 3A1, Abnova™

Name: pyruvate dehydrogenase kinase, isozyme 3, Mouse, Clone: 3A1, Abnova&trade;
Brand: Abnova
SKU: 16162575
Price: 326.00 EUR

Mouse monoclonal antibody raised against a partial recombinant PDK3.

Marke: Abnova H00005165-M02.100ug

Weitere Details : Netto-Gewicht : 0.00010kg

Artikelnummer. 16162575

Verfügbar ab: 16-05-2024
Sie sich ein, um den Lagerbestand zu sehen

Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Beschreibung

Sequence: GDTNPVHPKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAKAPDKPIQVVYVPSHLFHMLFELFKNSMRATVELYEDR

Spezifikation

Antigen	pyruvate dehydrogenase kinase, isozyme 3
Klassifikation	Monoclonal
Konjugat	Unconjugated
Zusammensetzung	PBS with no preservative; pH 7.4
Gen-Zugriffsnummer	BC015948
Wirtsspezies	Mouse
Reinigungsverfahren	Affinity Purified
Regulatorischer Status	RUO
Ganzes Molekül	Yes
Gen-ID (Entrez)	5165
Inhalt und Lagerung	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG1 κ

Anwendungen	ELISA, Western Blot
Klon	3A1
Beschreibung	Mouse monoclonal antibody raised against a partial recombinant PDK3.
Gen	PDK3
Gensymbole	PDK3
Immunogen	PDK3 (AAH15948, 174 a.a. ∼ 263 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Menge	100 μg
Forschungsgebiet	Kinases
Primär oder sekundär	Primary
Zielspezies	Human
Produkttyp	Antibody

Produktvorschläge

Beschreibung