missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. 16162825

phosphoinositide-3-kinase, catalytic, delta polypeptide, Mouse, Polyclonal Antibody, Abnova™

Artikelnummer. 16162825
Change view
Click to view available options
Menge:
50 μL
Packungsgröße:
50 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
16162825 50 μL 50 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 16162825 Lieferant Abnova Lieferanten-Nr. H00005293A01.50uL

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Mouse polyclonal antibody raised against a partial recombinant PIK3CD.

Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. See MIM 602838. The class I PI3Ks display a broad phosphoinositide lipid substrate specificity and include p110-alpha (MIM 171834), p110-beta (MIM 602925), and p110-gamma (MIM 601232). p110-alpha and p110-beta interact with SH2/SH3-domain-containing p85 adaptor proteins (see MIM 171833) and with GTP-bound Ras.[supplied by OMIM

Sequence: DFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSAQTWGPGTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRH

Spezifikation

Antigen phosphoinositide-3-kinase, catalytic, delta polypeptide
Anwendungen ELISA
Klassifikation Polyclonal
Konjugat Unconjugated
Beschreibung Mouse polyclonal antibody raised against a partial recombinant PIK3CD.
Zusammensetzung 50% glycerol
Gen PIK3CD
Gen-Zugriffsnummer NM_005026
Gen-Alias p110D
Gensymbole PIK3CD
Wirtsspezies Mouse
Immunogen PIK3CD (NP_005017, 138 a.a. ∼ 247 a.a) partial recombinant protein with GST tag.
Menge 50 μL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 5293
Zielspezies Human
Inhalt und Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.