missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. C8G Antibody, Novus Biologicals™

C8G Antibody, Novus Biologicals™

Artikelnummer. 18472611 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
0.1 mL
25ul
Packungsgröße:
0.10 Milliliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18472611 25ul 25 Mikroliter
18158631 0.1 mL 0.10 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18472611 Lieferant Novus Biologicals Lieferanten-Nr. NBP21442225ul

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

C8G Polyclonal specifically detects C8G in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen C8G
Anwendungen Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Zusammensetzung PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gen-Alias C8C, complement component 8, gamma polypeptide, complement component C8 gamma chain, MGC142186
Gensymbole C8G
Wirtsspezies Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: STIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARGARGAVHVVVAET
Reinigungsverfahren Affinity Purified
Menge 25ul
Regulatorischer Status RUO
Forschungsgebiet Immunology
Primär oder sekundär Primary
Gen-ID (Entrez) 733
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.