missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CA2 (Human) Recombinant Protein

Human CA2 partial ORF (NP_000058.1, 191 a.a. - 260 a.a.) recombinant protein with GST tag at N-terminal.

Marke:  Abnova™ H00000760-Q01.25ug

Weitere Details : Netto-Gewicht : 0.02000kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16043705

  • 482.88 € / 25 Mikrogramm

Verfügbar ab
06-05-2021

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

  • Sequence: WTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Spezifikation

Spezifikation

NP_000058.1
carbonic anhydrase II
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CA2
GST
760
Wheat germ expression system
25 μg
CA-II, CAII, Car2
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation