missing translation for 'onlineSavingsMsg'
Learn More

Carnosine Dipeptidase 1/CNDP1 Antibody, Novus Biologicals™

Artikelnummer. 18446151 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
0.1 mL
25 μL
Packungsgröße:
0.10 Milliliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18446151 25 μL 25 Mikroliter
18262778 0.1 mL 0.10 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18446151 Lieferant Novus Biologicals Lieferanten-Nr. NBP18552825ul

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Rabbit Polyclonal Antibody has been used in 5 publications

Carnosine Dipeptidase 1/CNDP1 Polyclonal specifically detects Carnosine Dipeptidase 1/CNDP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Carnosine Dipeptidase 1/CNDP1
Anwendungen Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Zusammensetzung PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gen-Alias beta-Ala-His dipeptidase, carnosinase 1, Carnosine dipeptidase 1, carnosine dipeptidase 1 (metallopeptidase M20 family), CN1MGC102737, CNDP dipeptidase 1, CPGL2MGC142072, EC 3.4.13.20, Glutamate carboxypeptidase-like protein 2, HsT2308, MGC10825, Serum carnosinase
Gensymbole CNDP1
Wirtsspezies Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHL
Reinigungsverfahren Affinity Purified
Menge 25 μL
Regulatorischer Status RUO
Forschungsgebiet Signal Transduction
Primär oder sekundär Primary
Gen-ID (Entrez) 84735
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.