missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Complement C4a Antibody, R&D Systems™

Complement C4a Antibody, R&D Systems™

Product Code. 18603806 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
18603806 0.1 mL 0.1mL
18697435 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18603806 Supplier Novus Biologicals Supplier No. NBP246783
  • ONLINE EXCLUSIVE PRICE
    593.50 €
    560.70 € / 0.1 Milliliter
    Sparen 32.80 €
    5% Rabatt
 Restricted Item
Verfügbar ab: 02-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Complement C4a Polyclonal antibody specifically detects Complement C4a in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Complement C4a
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2), 40% Glycerol
Gene Accession No. P0C0L5
Gene Alias C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2, C4, complement component 4A (Rodgers blood group), RG
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: LHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYG
Purification Method Immunogen affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Immunology, Innate Immunity
Primary or Secondary Primary
Gene ID (Entrez) 720
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Type Antibody
Form Purified
Isotype IgG
Product Line Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.