missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. Connexin 31/GJB3 Antibody - Azide and BSA Free, Novus Biologicals™

Connexin 31/GJB3 Antibody - Azide and BSA Free, Novus Biologicals™

Artikelnummer. 18673440 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
0.02 mL
0.1 mL
Packungsgröße:
0.02 Milliliter
0.10 Milliliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18673440 0.1 mL 0.10 Milliliter
18664890 0.02 mL 0.02 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18673440 Lieferant Novus Biologicals Lieferanten-Nr. NBP2924210.1ml

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Description

Rabbit Polyclonal Antibody

Connexin 31/GJB3 Polyclonal antibody specifically detects Connexin 31/GJB3 in Human, Mouse, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Spécification

Antigen Connexin 31/GJB3
Anwendungen Western Blot
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 1:2000-1:50000
Zusammensetzung PBS with 50% glycerol, pH7.3.
Gen-Alias connexin 31, connexin-31, Cx31, CX31MGC102938, DFNA2, DFNA2B, EKV, erythrokeratodermia variabilis, FLJ22486, gap junction beta-3 protein, gap junction protein, beta 3, 31kD (connexin 31), gap junction protein, beta 3, 31kDa, gap junction protein, beta 3, 31kDa (connexin 31)
Wirtsspezies Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Connexin 31/GJB3 (NP_076872.1). ERERRHRQKHGDQCAKLYDNAGKKHGGLWWTYLFSLIFKLIIEFLFLYLLHTLWHGFNMPRLVQCANVAPCPNIVDCYIARPTEKKIFTYFMVGASAVCIV
Reinigungsverfahren Affinity purified
Menge 0.1 mL
Regulatorischer Status RUO
Forschungsgebiet Cell Biology, Cytoskeleton Markers, Neuroscience, Signal Transduction
Primär oder sekundär Primary
Gen-ID (Entrez) 2707
Zielspezies Human, Mouse, Rat
Inhalt und Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.