missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ DLX2 (Human) Recombinant Protein
Human DLX2 partial ORF (NP_004396.1, 1 a.a. - 110 a.a.) recombinant protein with GST tag at N-terminal.
Marke: Abnova™ H00001746-Q02.25ug
Weitere Details : Netto-Gewicht : 0.02000kg
Beschreibung
- Sequence: MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVSTATDSSYYTNQQHPAGGGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDL
Spezifikation
| NP_004396.1 | |
| distal-less homeobox 2 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| DLX2 | |
| GST |
| 1746 | |
| Wheat germ expression system | |
| 25 μg | |
| TES-1, TES1 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |