missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ DLX2 (Human) Recombinant Protein

Human DLX2 partial ORF (NP_004396.1, 1 a.a. - 110 a.a.) recombinant protein with GST tag at N-terminal.

Marke:  Abnova™ H00001746-Q02.25ug

Weitere Details : Netto-Gewicht : 0.02000kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16043905

  • 482.88 € / 25 Mikrogramm

Verfügbar ab
07-05-2021

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

  • Sequence: MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVSTATDSSYYTNQQHPAGGGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDL
Spezifikation

Spezifikation

NP_004396.1
distal-less homeobox 2
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DLX2
GST
1746
Wheat germ expression system
25 μg
TES-1, TES1
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation