missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ EFNA3 (Human) Recombinant Protein
Human EFNA3 full-length ORF ( AAH17722, 1 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal.
Marke: Abnova™ H00001944-P01.10ug
Weitere Details : Netto-Gewicht : 0.00010kg
Beschreibung
- Sequence: MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS
Spezifikation
| AAH17722 | |
| ephrin-A3 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| EFNA3 | |
| GST |
| 1944 | |
| Wheat germ expression system | |
| 10 μg | |
| EFL2, EPLG3, Ehk1-L, LERK3 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |