missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ EIF4E (Human) Recombinant Protein

Human EIF4E full-length ORF ( AAH12611, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal.

Marke:  Abnova™ H00001977-P01.25ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16164431

  • 482.88 € / 25 Mikrogramm

Voraussichtliches Versanddatum: 08-12-2021

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

  • Sequence: MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLNRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
Spezifikation

Spezifikation

AAH12611
eukaryotic translation initiation factor 4E
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
EIF4E
GST
1977
Wheat germ expression system
25 μg
CBP, EIF4E1, EIF4EL1, EIF4F, MGC111573
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate