missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ ENSA (Human) Recombinant Protein

Human ENSA full-length ORF ( AAH00436, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal.

Marke:  Abnova™ H00002029-P01.25ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16184551

  • 467.00 € / 25 Mikrogramm

Verfügbar ab
21-12-2020

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

  • Sequence: MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE
Spezifikation

Spezifikation

AAH00436
endosulfine alpha
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ENSA
GST
2029
Wheat germ expression system
25 μg
MGC4319, MGC78563, MGC8394
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation