missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ ENSA (Human) Recombinant Protein
Human ENSA full-length ORF ( AAH00436, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal.
Marke: Abnova™ H00002029-P01.25ug
Weitere Details : Netto-Gewicht : 0.00010kg
Beschreibung
- Sequence: MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE
Spezifikation
| AAH00436 | |
| endosulfine alpha | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ENSA | |
| GST |
| 2029 | |
| Wheat germ expression system | |
| 25 μg | |
| MGC4319, MGC78563, MGC8394 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |