missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. ERAB Antibody, Novus Biologicals™

ERAB Antibody, Novus Biologicals™

Artikelnummer. 18482082 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
0.1 mL
25 μL
Packungsgröße:
0.10 Milliliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18482082 0.1 mL 0.10 Milliliter
18428271 25 μL 25 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18482082 Lieferant Novus Biologicals Lieferanten-Nr. NBP190333

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Polyclonal Antibody

ERAB Polyclonal antibody specifically detects ERAB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen ERAB
Anwendungen Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Zusammensetzung PBS (pH 7.2) and 40% Glycerol
Gen-Alias 17-beta-HSD 10, 17-beta-hydroxysteroid dehydrogenase 10, 17b-HSD10, 3-hydroxy-2-methylbutyryl-CoA dehydrogenase, ABAD, amyloid-beta peptide binding alcohol dehydrogenase, CAMR, DUPXp11.22, EC 1.1.1.178, EC 1.1.1.35, Endoplasmic reticulum-associated amyloid beta-peptide-binding protein, ERAB3-hydroxyacyl-CoA dehydrogenase type-2, HADH2AB-binding alcohol dehydrogenase, hydroxyacyl-Coenzyme A dehydrogenase, type II, hydroxyacyl-Coenzyme Adehydrogenase, type II, hydroxysteroid (17-beta) dehydrogenase 10, mental retardation, X-linked, syndromic 10, MHBD, Mitochondrial ribonuclease P protein 2,3-hydroxyacyl-CoA dehydrogenase type II, Mitochondrial RNase P protein 2, MRPP2HCD2, MRX17, MRX31, MRXS10, SCHAD, SDR5C1, short chain dehydrogenase/reductase family 5C, member 1, short chain L-3-hydroxyacyl-CoA dehydrogenase type 2, short chain type dehydrogenase/reductase XH98G2, Short-chain type dehydrogenase/reductase XH98G2, Type II HADH, XH98G2
Wirtsspezies Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: EAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQA
Reinigungsverfahren Immunogen affinity purified
Menge 0.1 mL
Regulatorischer Status RUO
Forschungsgebiet Cancer, Lipid and Metabolism
Primär oder sekundär Primary
Gen-ID (Entrez) 3028
Zielspezies Human
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.