missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ ERH (Human) Recombinant Protein

Human ERH full-length ORF ( AAH14301, 1 a.a. - 104 a.a.) recombinant protein with GST-tag at N-terminal.

Marke:  Abnova™ H00002079-P01.10ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16184651

  • 310.00 € / 10 Mikrogramm

Verfügbar ab
05-01-2021

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

  • Sequence: MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
Spezifikation

Spezifikation

AAH14301
enhancer of rudimentary homolog (Drosophila)
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ERH
GST
2079
Wheat germ expression system
10 μg
DROER, FLJ27340
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation