missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. FAM123C Antibody, R&D Systems™

FAM123C Antibody, R&D Systems™

Product Code. 18602906 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
18602906 25 μL 25µL
18118568 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18602906 Supplier Novus Biologicals Supplier No. NBP23871925ul
  • ONLINE EXCLUSIVE PRICE
    457.09 €
    391.65 € / 25 Mikroliter
    Sparen 65.44 €
    14% Rabatt
 Restricted Item
Verfügbar ab: 02-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Beskrivelse

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

FAM123C Polyclonal specifically detects FAM123C in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen FAM123C
Applications Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q8N944
Gene Alias family with sequence similarity 123C
Gene Symbols AMER3
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: SDFTRFWDSVNRSVRQQQRALLGPWLSGPQGTDRDQPRLDTAGLAELPLCPCRDPRSGSKASSIDTGTPKSEQPESVSTS
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 205147
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Product Type Antibody
Isotype IgG
Product Line Novus
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.