missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ FHL3 (Human) Recombinant Protein

Human FHL3 full-length ORF ( AAH01351.1, 1 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal.

Marke:  Abnova™ H00002275-P01.25ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16165001

  • 482.88 € / 25 Mikrogramm

Voraussichtliches Versanddatum: 13-12-2021

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

  • Sequence: MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP
Spezifikation

Spezifikation

AAH01351.1
four and a half LIM domains 3
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FHL3
GST
2275
Wheat germ expression system
25 μg
MGC19547, MGC23614, MGC8696, SLIM2
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate