missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ FKBP1B (Human) Recombinant Protein

Human FKBP1B full-length ORF ( AAH02614, 1 a.a. - 80 a.a.) recombinant protein with GST-tag at N-terminal.

Marke:  Abnova™ H00002281-P01.25ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16185011

  • 467.00 € / 25 Mikrogramm

Verfügbar ab
30-12-2020

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

  • Sequence: MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC
Spezifikation

Spezifikation

AAH02614
FK506 binding protein 1B, 12.6 kDa
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FKBP1B
GST
2281
Wheat germ expression system
25 μg
FKBP12.6, FKBP1L, OTK4, PKBP1L, PPIase
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation