missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ FKBP8 Recombinant Protein
Human FKBP8 full-length ORF ( AAH09966, 1 a.a. - 355 a.a.) recombinant protein with GST-tag at N-terminal
Marke: Abnova™ H00023770-P01.25ug
Weitere Details : Netto-Gewicht : 0.00010kg
Beschreibung
The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. Unlike the other members of the family, this encoded protein does not seem to have PPIase/rotamase activity. It may have a role in neurons associated with memory function. (provided by RefSeq)
- Molecular weight: 64.79kDa
- Preparation method: in vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 Fast Flow
- Storage Buffer:50mM Tris-HCI, 10mM reduced Glutathione, pH 8 in the elution buffer
- Quality Control Testing: 12.5% SDS-PAGE stained with Coomassie Blue
Best use within three months from the date of receipt of this protein
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Spezifikation
| AAH09966 | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 64.79 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| 25 ug | |
| MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGPVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRRRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN | |
| FKBP38/FKBPr38 | |
| FKBP8 | |
| Wheat Germ (in vitro) | |
| GST |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 23770 | |
| FKBP8 (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FKBP8 | |
| Human | |
| Recombinant | |
| Solution |