missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. Gasdermin-C Antibody, Novus Biologicals™

Gasdermin-C Antibody, Novus Biologicals™

Artikelnummer. 30227227 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
20 μL
100 μL
Packungsgröße:
100 Mikroliter
20 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
30227227 100 μL 100 Mikroliter
30226797 20 μL 20 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 30227227 Lieferant Novus Biologicals Lieferanten-Nr. NBP335443100ul

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Description

Rabbit Polyclonal Antibody

Gasdermin-C Polyclonal antibody specifically detects Gasdermin-C in Human,Mouse samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen Gasdermin-C
Anwendungen ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 1:100 - 1:500, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
Zusammensetzung PBS (pH 7.3), 50% glycerol
Gen-Alias gasdermin C, gasdermin-C, Melanoma-derived leucine zipper-containing extranuclear factor, MLZEmelanoma-derived leucine zipper, extra-nuclear factor
Wirtsspezies Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Gasdermin-C (NP_113603.1).,, Sequence:, MPSMLERISKNLVKEIGSKDLTPVKYLLSATKLRQFVILRKKKDSRSSFWEQSDYVPVEFSLNDILEPSSSVLETVVTGPFHFSDIMIQKHKADMGVNVG
Reinigungsverfahren Affinity purified
Menge 100 μL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 56169
Zielspezies Human, Mouse
Inhalt und Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.