missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ GNG11 (Human) Recombinant Protein

Human GNG11 full-length ORF ( AAH09709, 1 a.a. - 73 a.a.) recombinant protein with GST-tag at N-terminal.

Marke:  Abnova™ H00002791-P01.10ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16165591

  • 320.54 € / 10 Mikrogramm

Voraussichtliches Versanddatum: 13-12-2021

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

  • Sequence: MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSCVIS
Spezifikation

Spezifikation

AAH09709
guanine nucleotide binding protein (G protein), gamma 11
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
GNG11
GST
2791
Wheat germ expression system
10 μg
GNGT11
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate