missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ GSTP1 (Human) Recombinant Protein

Human GSTP1 full-length ORF ( AAH10915, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal.

Marke:  Abnova™ H00002950-P01.25ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16185841

  • 467.00 € / 25 Mikrogramm

Verfügbar ab
21-12-2020

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

  • Sequence: MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPEFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Spezifikation

Spezifikation

AAH10915
glutathione S-transferase pi 1
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
GSTP1
GST
2950
Wheat germ expression system
25 μg
DFN7, FAEES3, GST3, PI
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation