missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ GSTP1 (Human) Recombinant Protein
Human GSTP1 full-length ORF ( AAH10915, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal.
Marke: Abnova™ H00002950-P01.25ug
Weitere Details : Netto-Gewicht : 0.00010kg
Beschreibung
- Sequence: MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPEFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Spezifikation
| AAH10915 | |
| glutathione S-transferase pi 1 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| GSTP1 | |
| GST |
| 2950 | |
| Wheat germ expression system | |
| 25 μg | |
| DFN7, FAEES3, GST3, PI | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |