missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ HLA-DRB4 (Human) Recombinant Protein

Human HLA-DRB4 full-length ORF ( AAH05312, 30 a.a. - 266 a.a.) recombinant protein with GST-tag at N-terminal.

Marke:  Abnova™ H00003126-P01.25ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16186171

  • 467.00 € / 25 Mikrogramm

Verfügbar ab
05-01-2021

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

  • Sequence: GDTQPRFLEQAKCECRFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS
Spezifikation

Spezifikation

AAH05312
major histocompatibility complex, class II, DR beta 4
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HLA-DRB4
GST
3126
Wheat germ expression system
25 μg
DRB4, HLA-DR4B
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation