missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human A2ML1 Full-length ORF (AAH93840.1, 1 a.a. - 158 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00144568-P01.10ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Code produit. 16168343

  • 320.54 € / 10 Mikrogramm

Voraussichtliches Versanddatum: 19-11-2021

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Description

Description

The alpha-macroglobulin (AM) superfamily of proteins contains both complement components and protease inhibitors, including A2M (MIM 103950) and A2ML1. AM proteins display a unique trap mechanism of inhibition, by which the AM inhibitor undergoes a major conformational change upon its cleavage by a protease, thus trapping the protease and blocking it from subsequent substrate binding (Galliano et al., 2006 [PubMed 16298998]).[supplied by OMIM]

Sequence: MYTLEASGQGCVYVQTVLRYNILPPTNMKTFSLSVEIGKARCEQPTSPRSLTLTIHTSYVGSRSSSNMAIVEVKMLSGFSPMEGTNQLLLQQPLVKKVEFGTDTLNIYLDELIKNTQTYTFTISQSVLVTNLKPATIKVYDYYLPDEQATIQYSDPCE
Spécification

Spécification

AAH93840.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
44.1kDa
Glutathione Sepharose 4 Fast Flow
10 ug
RUO
A2ML1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
144568
A2ML1 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CPAMD9/DKFZp686C1729/DKFZp686D2011/DKFZp686G1812/DKFZp686L1821/DKFZp686O1010/FLJ16045/FLJ25179/FLJ39129/FLJ41597/FLJ41598/FLJ41607
A2ML1
Yes
Vidéos
FDS
Documents
Certificats