missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ATP11B Partial ORF (NP_055431, 1087 a.a. - 1177 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00023200-Q01.10ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16164476

  • 320.54 € / 10 Mikrogramm

Voraussichtliches Versanddatum: 15-11-2021

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

P-type ATPases, such as ATP11B, are phosphorylated in their intermediate state and drive uphill transport of ions across membranes. Several subfamilies of P-type ATPases have been identified. One subfamily transports heavy metal ions, such as Cu(2+) or Cd(2+). Another subfamily transports non-heavy metal ions, such as H(+), Na(+), K(+), or Ca(+). A third subfamily transports amphipaths, such as phosphatidylserine.[supplied by OMIM]

Sequence: DIIKKVFDRHLHPTSTEKAQLTETNAGIKCLDSMCCFPEGEAACASVGRMLERVIGRCSPTHISRSWSASDPFYTNDRSILTLSTMDSSTC
Spezifikation

Spezifikation

NP_055431
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.75kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
DIIKKVFDRHLHPTSTEKAQLTETNAGIKCLDSMCCFPEGEAACASVGRMLERVIGRCSPTHISRSWSASDPFYTNDRSILTLSTMDSSTC
RUO
ATP11B
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
23200
ATP11B (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ATPIF/ATPIR/DKFZp434J238/DKFZp434N1615/KIAA0956/MGC46576
ATP11B
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate