missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human BAT4 Partial ORF (NP_149417, 257 a.a. - 356 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00007918-Q01.25ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16168065

  • 482.88 € / 25 Mikrogramm

Voraussichtliches Versanddatum: 13-12-2021

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. The protein encoded by this gene is thought to be involved in some aspects of immunity. [provided by RefSeq]

Sequence: SPGFKLLLRGGWEPGMGLGPRGEGRANPIPTVLKRDQEGLGYRSAPQPRVTHFPAWDTRAVAGRERPPRVATLSWREERRREEKDRAWERDLRTYMNLEF
Spezifikation

Spezifikation

NP_149417
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SPGFKLLLRGGWEPGMGLGPRGEGRANPIPTVLKRDQEGLGYRSAPQPRVTHFPAWDTRAVAGRERPPRVATLSWREERRREEKDRAWERDLRTYMNLEF
RUO
BAT4
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
7918
BAT4 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ANKRD59/D6S54E/G5/GPANK1/GPATCH10
BAT4
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate