missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. 30181961

Invitrogen™ Human C14orf80 (aa 153-241) Control Fragment Recombinant Protein

Artikelnummer. 30181961
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
30181961 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 30181961 Lieferant Invitrogen™ Lieferanten-Nr. RP97615

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58637 (PA5-58637. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C14orf80 may play a role in counteracting perturbation of actin filaments, such as after treatment with the actin depolymerizing microbial metabolite Chivosazole F.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer Q86SX3
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 283643
Name Human C14orf80 (aa 153-241) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias C14orf80; chromosome 14 open reading frame 80; TEDC1; Tubulin epsilon and delta complex protein 1; uncharacterized protein C14orf80
Gebräuchliche Bezeichnung C14orf80
Gensymbol TEDC1
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz PAPHMEAEGPVDVRHVQWLMGKLRFRWRQLVSSQQEQCALLSKIHLYTRGCHSDQSLSHLSVTEAEMLRDPEGGQQVSGAGAAQNLDLA
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.