missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CAPN3 Partial ORF (AAH03169.1, 210 a.a. - 309 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000825-Q01.25ug

Additional Details : Netto-Gewicht : 0.00010kg

 View more versions of this product

Product Code. 16185604

  • 467.00 € / 25 Mikrogramm

Verfügbar ab
05-01-2021

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Description

Description

Sequence: NKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA
Specifications

Specifications

AAH03169.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
NKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA
RUO
CAPN3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
825
CAPN3 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CANP3|CANPL3|LGMD2|LGMD2A|MGC10767|MGC11121|MGC14344|MGC4403|nCL-1|p94
CAPN3
Yes
Videos
SDS
Documents