missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CAPZA2 Partial ORF (NP_006127, 111 a.a. - 169 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00000830-Q01.10ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16165624

  • 320.54 € / 10 Mikrogramm

Voraussichtliches Versanddatum: 26-11-2021

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

The protein encoded by this gene is a member of the F-actin capping protein alpha subunit family. It is the alpha subunit of the barbed-end actin binding protein Cap Z. By capping the barbed end of actin filaments, Cap Z regulates the growth of the actin filaments at the barbed end. [provided by RefSeq]

Sequence: CEVENAVESWRTSVETALRAYVKEHYPNGVCTVYGKKIDGQQTIIACIESHQFQAKNFW
Spezifikation

Spezifikation

NP_006127
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.23kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
CEVENAVESWRTSVETALRAYVKEHYPNGVCTVYGKKIDGQQTIIACIESHQFQAKNFW
RUO
CAPZA2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
830
CAPZA2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CAPPA2/CAPZ
CAPZA2
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate