missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human Cep290 Full-length ORF (AAH08641.1, 1 a.a. - 164 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00080184-P01.25ug
Weitere Details : Netto-Gewicht : 0.00010kg
Beschreibung
This gene encodes a protein with 13 putative coiled-coil domains, a region with homology to SMC chromosome segregation ATPases, six KID motifs, three tropomyosin homology domains and an ATP/GTP binding site motif A. The protein is localized to the centrosome and cilia and has sites for N-glycosylation, tyrosine sulfation, phosphorylation, N-myristoylation, and amidation. Mutations in this gene have been associated with Joubert syndrome and nephronophthisis and the presence of antibodies against this protein is associated with several forms of cancer. [provided by RefSeq]
Sequence: MAIFKIAALQKVVDNSVSLSELELANKQYNELTAKYRDILQKDNMLVQRTSNLEHLECENISLKEQVESINKELEITKEKLHTIEQAWEQETKLGNESSMDKAKKSITNSDIVSISKKITMLEMKELNERQRAEHCQKMYEHLRTSLKQMEERNFELETKFAEVSpezifikation
| AAH08641.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 45.6kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| 3H11Ag/BBS14/FLJ13615/FLJ21979/JBTS5/JBTS6/KIAA0373/LCA10/MKS4/NPHP6/SLSN6/rd16 | |
| CEP290 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 80184 | |
| Cep290 (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MAIFKIAALQKVVDNSVSLSELELANKQYNELTAKYRDILQKDNMLVQRTSNLEHLECENISLKEQVESINKELEITKEKLHTIEQAWEQETKLGNESSMDKAKKSITNSDIVSISKKITMLEMKELNERQRAEHCQKMYEHLRTSLKQMEERNFELETKFAEV | |
| RUO | |
| CEP290 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |