missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human Chac1 Full-Length Orf (Np_077016.1, 1 A.A.-222 A.A.) Recombinant Protein With Gst Tag At N-Terminal.

Recombinant proteins expressed from in vitro wheat germ system. Such proteins mirror the conformation and folding of the native proteins in the eukaryotic biological system.

Marke:  Abnova™ H00079094-P01.10ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16163519

  • 320.54 € / 10 Mikrogramm

Voraussichtliches Versanddatum: 26-11-2021

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

  • Good Folding
  • Excellent amino acids labeling

Immunogen Sequence: MKQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKALAYVAT

Spezifikation

Spezifikation

NP_077016.1
Liquid
79094
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC4504
CHAC1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
CHAC1 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue
MKQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKALAYVATPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTMLPCFCPTEQALALV
RUO
CHAC1
GST
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate

For Research Use Only