missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human COX4NB Partial ORF (NP_006058.1, 113 a.a. - 210 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00010328-Q01.25ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16162366

  • 482.88 € / 25 Mikrogramm

Voraussichtliches Versanddatum: 29-11-2021

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

Sequence: SRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC
Spezifikation

Spezifikation

NP_006058.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.52kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC
RUO
COX4NB
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
10328
COX4NB (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
C16orf2/C16orf4/FAM158B/NOC4
COX4NB
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate