missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CRIP2 Full-length ORF (NP_001303.1, 1 a.a. - 208 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

341.70 € - 518.16 €

Spezifikation

Name CRIP2 (Human) Recombinant Protein (P02)
Rekombinant Yes
Reinigungsverfahren Glutathione Sepharose 4 Fast Flow
Zur Verwendung mit (Anwendung) Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Molekulargewicht 48.9kDa
Mehr Spezifikationen ansehen

Produkte 2
Produktcode Marke Menge Preis Menge & Verfügbarkeit  
Produktcode Marke Menge Preis Menge & Verfügbarkeit  
16173511
Unterlagen ansehen Aktionsdetails
Abnova™
H00001397-P02.25UG
25 ug
518.16 €
25 Mikrogramm
Alternative Produkte anzeigen
Sparen Sie bis zu 
»
Voraussichtliches Versanddatum: 10-01-2022
Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!
16163511
Unterlagen ansehen Aktionsdetails
Abnova™
H00001397-P02.10UG
10 ug
341.70 €
10 Mikrogramm
Alternative Produkte anzeigen
Sparen Sie bis zu 
»
Voraussichtliches Versanddatum: 10-01-2022
Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!
Beschreibung

Beschreibung

Sequence: MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP
Spezifikation

Spezifikation

CRIP2 (Human) Recombinant Protein (P02)
Glutathione Sepharose 4 Fast Flow
48.9kDa
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Sicherheitsdatenblatt (SDS)
Produktzertifizierungen