missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. 30198800

Invitrogen™ Human Cytochrome B5 Control Fragment Recombinant Protein

Artikelnummer. 30198800
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
30198800 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 30198800 Lieferant Invitrogen™ Lieferanten-Nr. RP103776

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63584 (PA5-63584. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cytochrome b5 is a membrane-bound member of the cytochrome b family. A heme protein that functions as an electron carrier for many membrane-bound oxygenases, cytochrome b5 possesses two heme groups, which are not covalently attached to the protein. Two isoforms of cytochrome b5, a microsomal membrane-bound form and a cytoplasmic form, are produced by alternative splicing. Mutations in cytochrome b5 are associated with Leber's hereditary optic neuropathy and with myopathy.
TRUSTED_SUSTAINABILITY

Specifications

Zugriffsnummer P00167
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 1528
Name Human Cytochrome B5 Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias 0610009N12Rik; Cyb5; CYB5A; cytochrome b5; cytochrome b-5; cytochrome b5 type A; cytochrome b5 type A (microsomal); MCB5; Microsomal cytochrome b5 type A; type 1 cyt-b5
Gebräuchliche Bezeichnung Cytochrome B5
Gensymbol CYB5A
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLAEHPGG
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.