missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human DNASE2B Partial ORF (NP_067056, 258 a.a. - 357 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

341.70 € - 518.16 €

Spezifikation

Name DNASE2B (Human) Recombinant Protein (Q01)
Rekombinant Yes
Zur Verwendung mit (Anwendung) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Molekulargewicht 36.74kDa
Lagerungsbedingungen Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Mehr Spezifikationen ansehen

Produkte 2
Produktcode Marke Menge Preis Menge & Verfügbarkeit  
Produktcode Marke Menge Preis Menge & Verfügbarkeit  
16179326
Unterlagen ansehen Aktionsdetails
Abnova™
H00058511-Q01.25UG
25 ug
518.16 €
25 Mikrogramm
Alternative Produkte anzeigen
Sparen Sie bis zu 
»
Voraussichtliches Versanddatum: 24-01-2022
Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!
16169326
Unterlagen ansehen Aktionsdetails
Abnova™
H00058511-Q01.10UG
10 ug
341.70 €
10 Mikrogramm
Alternative Produkte anzeigen
Sparen Sie bis zu 
»
Voraussichtliches Versanddatum: 24-01-2022
Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!
Beschreibung

Beschreibung

The protein encoded by this gene shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this gene product is restricted to the salivary gland and lungs. The gene has been localized to chromosome 1p22.3 adjacent (and in opposite orientation) to the uricase pseudogene. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq]

Sequence: HLLTETWQRKRQELPSNCSLPYHVYNIKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGGFICTQNWQIYQAFQGLVLYYESCK
Spezifikation

Spezifikation

DNASE2B (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
36.74kDa
Sicherheitsdatenblatt (SDS)
Produktzertifizierungen