Learn More
Abnova™ Human DUSP5 Partial ORF (NP_004410, 286 a.a. - 384 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00 € - 508.00 €
Spezifikation
Zugriffsnummer | NP_004410 |
---|---|
Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gen-ID (Entrez) | 1847 |
Molekulargewicht | 36.63kDa |
Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
---|---|---|---|---|---|---|---|---|---|
Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
16177384
|
Abnova™
H00001847-Q01.25UG |
25 ug |
508.00 €
25 Mikrogramm |
Verfügbar ab: 31-05-2024 Loggen Sie sich ein, um den Lagerbestand zu sehen |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | ||||
16167384
|
Abnova™
H00001847-Q01.10UG |
10 ug |
335.00 €
10 Mikrogramm |
Verfügbar ab: 31-05-2024 Loggen Sie sich ein, um den Lagerbestand zu sehen |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | ||||
Beschreibung
The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK1, is expressed in a variety of tissues with the highest levels in pancreas and brain, and is localized in the nucleus. [provided by RefSeq]
Sequence: LKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSCSpezifikation
NP_004410 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.63kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
DUSP/HVH3 | |
DUSP5 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
1847 | |
DUSP5 (Human) Recombinant Protein (Q01) | |
LKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC | |
RUO | |
DUSP5 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |