missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human DUSP9 Partial ORF (NP_001386, 174 a.a. - 278 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00001852-Q01.2ug
Weitere Details : Netto-Gewicht : 0.00010kg
Beschreibung
The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which is associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product shows selectivity for members of the ERK family of MAP kinases, is expressed only in placenta, kidney, and fetal liver, and is localized to the cytoplasm and nucleus. [provided by RefSeq]
Sequence: AESEADRDSMSCGLDSEGATPPPVGLRASFPVQILPNLYLGSARDSANLESLAKLGIRYILNVTPNLPNFFEKNGDFHYKQIPISDHWSQNLSRFFPEAIEFIDESpezifikation
| NP_001386 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.29kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| 2 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MKP-4/MKP4 | |
| DUSP9 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 1852 | |
| DUSP9 (Human) Recombinant Protein (Q01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| AESEADRDSMSCGLDSEGATPPPVGLRASFPVQILPNLYLGSARDSANLESLAKLGIRYILNVTPNLPNFFEKNGDFHYKQIPISDHWSQNLSRFFPEAIEFIDE | |
| RUO | |
| DUSP9 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |