missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human EARS2 (aa 345-434) Control Fragment Recombinant Protein

Artikelnummer. 30181269
Change view
Click to view available options
Menge:
100 μl
Unit Size:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Menge unitSize
30181269 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30181269 Supplier Invitrogen™ Supplier No. RP98632

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60312 (PA5-60312. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glutamyl-tRNA synthetase (GluRS or EARS2) a class I aminoacyl-tRNA synthetase (aaRS), is primarily responsible for the glutamylation of tRNAGlu. It is part of the 'minimal set' of seventeen aaRSs found in every living organism and its presence is essential for the viability of cells.
TRUSTED_SUSTAINABILITY

Specifications

Zugriffsnummer Q5JPH6
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 124454
Name Human EARS2 (aa 345-434) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias 3230401I01Rik; COXPD12; Ears2; GluRS; glutamate tRNA ligase 2, mitochondrial; glutamate--tRNA ligase; Glutamyl-tRNA synthetase; glutamyl-tRNA synthetase 2 (mitochondrial)(putative); glutamyl-tRNA synthetase 2 mitochondrial (putative); glutamyl-tRNA synthetase 2, mitochondrial; Kiaa1970; mKIAA1970; MSE1; Probable glutamate--tRNA ligase, mitochondrial; probable glutamyl-tRNA synthetase, mitochondrial; RGD1307904
Gebräuchliche Bezeichnung EARS2
Gensymbol Ears2
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz LLDLEKLPEFNRLHLQRLVSNESQRRQLVGKLQVLVEEAFGCQLQNRDVLNPVYVERILLLRQGHICRLQDLVSPVYSYLWTRPAVGRAQ
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.