missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human F12 Partial ORF (AAH12390, 191 a.a. - 300 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

310.00 € - 467.00 €

Spezifikation

Name F12 (Human) Recombinant Protein (Q01)
Rekombinant Yes
Zur Verwendung mit (Anwendung) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Molekulargewicht 37.84kDa
Lagerungsanforderungen Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Mehr Spezifikationen ansehen

Produkte 2
Produktcode Marke Menge Preis Menge & Verfügbarkeit  
Produktcode Marke Menge Preis Menge & Verfügbarkeit  
16194761
Unterlagen ansehen
Abnova™
H00002161-Q01.25UG
25 ug
467.00 €
25 Mikrogramm
Alternative Produkte anzeigen
Sparen Sie bis zu 
»
Verfügbar ab
22-02-2021
Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!
16184761
Unterlagen ansehen
Abnova™
H00002161-Q01.10UG
10 ug
310.00 €
10 Mikrogramm
Alternative Produkte anzeigen
Sparen Sie bis zu 
»
Verfügbar ab
22-02-2021
Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!
Beschreibung

Beschreibung

This gene encodes coagulation factor XII which circulates in blood as a zymogen. This single chain zymogen is converted to a two-chain serine protease with an heavy chain (alpha-factor XIIa) and a light chain. The heavy chain contains two fibronectin-type domains, two epidermal growth factor (EGF)-like domains, a kringle domain and a proline-rich domain, whereas the light chain contains only a catalytic domain. On activation, further cleavages takes place in the heavy chain, resulting in the production of beta-factor XIIa light chain and the alpha-factor XIIa light chain becomes beta-factor XIIa heavy chain. Prekallikrein is cleaved by factor XII to form kallikrein, which then cleaves factor XII first to alpha-factor XIIa and then to beta-factor XIIa. The active factor XIIa participates in the initiation of blood coagulation, fibrinolysis, and the generation of bradykinin and angiotensin. It activates coagulation factors VII and XI. Defects in this gene do not cause any clinical symptoms and the sole effect is that whole-blood clotting time is prolonged. [provided by RefSeq]

Sequence: GHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIREHTVS
Spezifikation

Spezifikation

F12 (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
37.84kDa
Sicherheitsdatenblatt (SDS)