missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. 30204407

Invitrogen™ Human FAM132A (aa 70-138) Control Fragment Recombinant Protein

Artikelnummer. 30204407
Change view
Click to view available options
Menge:
100 μl
Unit Size:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Menge unitSize
30204407 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30204407 Supplier Invitrogen™ Supplier No. RP90538

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54980 (PA5-54980. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Insulin-sensitizing adipocyte-secreted protein (adipokine) that regulates glucose metabolism in liver and adipose tissue. Promotes glucose uptake in adipocytes and suppresses de novo glucose production in hepatocytes via the PI3K-Akt signaling pathway. Administration lead to reduction of blood glucose. Able to attenuate inflammation in fat tissue. [UniProt]
TRUSTED_SUSTAINABILITY

Specifications

Zugriffsnummer Q5T7M4
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 388581
Name Human FAM132A (aa 70-138) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias Adipolin; Adipolin cleaved form; Adipolin fC1QTNF12; Adipolin fCTRP12; Adipolin full-length form; Adipolin gC1QTNF12; Adipolin gCTRP12; Adipose-derived insulin-sensitizing factor; C1q and TNF related 12; C1q and TNF related protein 12; C1q domain containing 2; C1q/TNF-related protein 12; C1QDC2; C1QTNF12; Complement C1q tumor necrosis factor-related protein 12; CTRP12; FAM132A; family with sequence similarity 132 member A; family with sequence similarity 132, member A; protein FAM132A; zgc:158358
Gebräuchliche Bezeichnung FAM132A
Gensymbol C1QTNF12
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz DAHMTWLNFVRRPDDGALRKRCGSRDKKPRDLFGPPGPPGAEVTAETLLHEFQELLKEATERRFSGLLD
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.