missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FLT4 Partial ORF (NP_002011, 34 a.a. - 133 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00002324-Q01.25ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16168264

  • 518.16 € / 25 Mikrogramm
Voraussichtliches Versanddatum: 24-01-2022

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

This gene encodes a tyrosine kinase receptor for vascular endothelial growth factors C and D. The protein is thought to be involved in lymphangiogenesis and maintenance of the lymphatic endothelium. Mutations in this gene cause hereditary lymphedema type IA. [provided by RefSeq]

Sequence: ITEESHVIDTGDSLSISCRGQHPLEWAWPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVR
Spezifikation

Spezifikation

NP_002011
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
ITEESHVIDTGDSLSISCRGQHPLEWAWPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVR
RUO
FLT4
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
2324
FLT4 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLT41/LMPH1A/PCL/VEGFR3
FLT4
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate
Sonderangebote

Sonderangebote