Learn More
Abnova™ Human FOXD2 Partial ORF (NP_004465.2, 411 a.a. - 494 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00002306-Q01.25ug
Weitere Details : Netto-Gewicht : 0.00010kg
Beschreibung
This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined. [provided by RefSeq]
Sequence: SFSIDHIMGHGGGGAAPPGAGEGSPGPPFAAAAGPGGQAQVLAMLTAPALAPVAGHIRLSHPGDALLSSGSRFASKVAGLSGCHSpezifikation
NP_004465.2 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
34.98kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
SFSIDHIMGHGGGGAAPPGAGEGSPGPPFAAAAGPGGQAQVLAMLTAPALAPVAGHIRLSHPGDALLSSGSRFASKVAGLSGCH | |
RUO | |
FOXD2 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
2306 | |
FOXD2 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
FKHL17/FREAC-9/FREAC9 | |
FOXD2 | |
Recombinant | |
wheat germ expression system |