Learn More
Abnova™ Human GCHFR Full-length ORF (NP_005249.1, 1 a.a. - 84 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00002644-P01.25ug
Weitere Details : Netto-Gewicht : 0.00010kg
Beschreibung
GTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine metabolism in the liver and in the production of biogenic amine neurotransmitters and nitric oxide. [provided by RefSeq]
Sequence: MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKESpezifikation
NP_005249.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.1kDa | |
Glutathione Sepharose 4 Fast Flow | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
GFRP/HsT16933/MGC138467/MGC138469/P35 | |
GCHFR | |
Recombinant | |
wheat germ expression system |
Antibody Production, Protein Array, ELISA, Western Blot | |
2644 | |
GCHFR (Human) Recombinant Protein (P01) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE | |
RUO | |
GCHFR | |
Wheat Germ (in vitro) | |
GST | |
Liquid |