missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human GORASP2 Partial ORF (NP_056345, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00 € - 508.00 €
Spezifikation
| Zugriffsnummer | NP_056345 |
|---|---|
| Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
| Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gen-ID (Entrez) | 26003 |
| Molekulargewicht | 36.74kDa |
| Code produit | Marque | Menge | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Menge | Prix | Quantité et disponibilité | |||||
|
16175256
|
Abnova™
H00026003-Q01.10UG |
10 ug |
335.00 €
10 Mikrogramm |
Verfügbar ab: 29-05-2024 Loggen Sie sich ein, um den Lagerbestand zu sehen |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | ||||
|
16185256
|
Abnova™
H00026003-Q01.25UG |
25 ug |
508.00 €
25 Mikrogramm |
Verfügbar ab: 29-05-2024 Loggen Sie sich ein, um den Lagerbestand zu sehen |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | ||||
Description
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in establishing the stacked structure of the Golgi apparatus. [provided by RefSeq]
Sequence: MGSSQSVEIPGGGTEGYHVLRVQENSPGHRAGLEPFFDFIVSINGSRLNKDNDTLKDLLKANVEKPVKMLIYSSKTLELRETSVTPSNLWGGQGLLGVSISpécification
| NP_056345 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.74kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| DKFZp434D156/FLJ13139/GOLPH6/GRASP55/GRS2/p59 | |
| GORASP2 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 26003 | |
| GORASP2 (Human) Recombinant Protein (Q01) | |
| MGSSQSVEIPGGGTEGYHVLRVQENSPGHRAGLEPFFDFIVSINGSRLNKDNDTLKDLLKANVEKPVKMLIYSSKTLELRETSVTPSNLWGGQGLLGVSI | |
| RUO | |
| GORASP2 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |